AM20437PU-NART3 / TMART (29-139) antibody

Product: AM20437PU-NART3 / TMART (29-139) antibody
Quantity: 50 µg
Synonyms: Ecto-ADP-ribosyltransferase 3, Mono(ADP-ribosyl)transferase 3, NAD(P)(+)-arginine ADP-ribosyltransferase 3
Presentation: Purified
Clonality: Monoclonal
Host: Mouse
Isotype: IgG2b
CAS NO: 459168-41-3 Product: JNJ-7777120
Shipping to: Worldwide
Immunogen: ART3 (NP_001170, 29 a.a. ~ 139 a.a) partial recombinant protein with GST tagAA Sequence:LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF (without GST)GeneID:419Remarks:MW of the GST tag alone i
Application: Sandwich ELISA (Recombinant protein).Western blot (Recombinant protein).Immunohistochemistry on Paraffin Sections: 5 µg/ml.Immunohistochemistry on Formalin/PFA-Fixed Paraffin-Embedded Sections: 2-5 µg/ml.Positive Control: Human Testis.
Background:
Concentration: 0.45 mg/ml
Storage: Upon receipt, store undiluted (in aliquots) at -20°C. Avoid repeated freezing and thawing.Shelf life: one year from despatch.
Buffer System: PBS, pH 7.4
Preservatives:
State: Liquid purified IgG fractionPurified
Specifictiy: Recognizes Adp-ribosyltransferase 3 (ART3)

Leave a Reply