Product: 75-122Ataxin-1 antibody
Quantity: 0.1 ml
Synonyms: ATX1, ATXN1, Ataxin 1, SCA1, Spinocerebellar ataxia type 1 protein
Presentation: Purified
Clonality: Monoclonal
Host: Mouse
Isotype: IgG1
CAS NO: 1022152-70-0 Product: MK-5046
Shipping to: Worldwide
Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (also known as spinocerebellar ataxia type 1 protein homolog, accession number P54254).Rat: 100% identity (34/34 amino acids identical).Human: 88% identity (30/34
Application: Immunoblot (IB)Immunohistochemistry (IHC)Immunoprecipitation (IP)
Background:
Concentration:
Storage:
Buffer System:
Preservatives:
State: Purified
Specifictiy:

Related Post