Product: AM20470PU-NARVCF antibody
Quantity: 50 µg
Synonyms: Armadillo repeat protein deleted in velo-cardio-facial syndrome
Presentation: Purified
Clonality: Monoclonal
Host: Mouse
Isotype: IgG1
CAS NO: 20324-87-2 Product: AMI-1
Shipping to: Worldwide
Immunogen: ARVCF (NP_001661, 863 a.a. ~ 963 a.a) partial recombinant protein with GST tag.AA Sequence:LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPRGASSAGEASEKEPLKLDPSRKAPPPG PSRPAVRLVDAVGDAKPQPVDSWV*GeneID:421Remarks:MW of the GST tag alone is 26 KDa.
Application: ELISA.Wewstern Blot (Cell lysate): Use A-431 as Positive ControlImmunohistochemistry on Paraffin Sections: 5 µg/ml.
Background: ARVCF (Armadillo Repeat gene deleted in Velo-Cardio-Facial syndrome) is a member of the catenin family and may be involved in protein-protein interactions at adherens junctions. ARVCF contains a coiled coil domain in the N-terminus and a 10 armadillo repe
Concentration:
Storage: Store the antibody at -20°C.Aliquot to avoid freeze/thaw cycles.Shelf life: one year from despatch.
Buffer System: PBS, pH 7.2
Preservatives:
State: Liquid purified IgG fractionPurified
Specifictiy: Recognizes ARVCF