Product: TA329948BRF1 / TFIIIB90 antibody
Quantity: 0.1 mg
Synonyms: B-related factor 1, BRF, GTF3B, RNA polymerase III subunit 2, TAF3B2, TAF3C, TATA box-binding protein-associated factor, Transcription factor IIIB 90 kDa subunit
Presentation: Purified
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
CAS NO: 666179-74-4 Product: Risperidone (hydrochloride)
Shipping to: Europe, USA/Canada
Immunogen: The immunogen for anti-BRF1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG.
Application: WB
Background: BRF1 is one of the three subunits of the R polymerase III transcription factor complex. This complex plays a central role in transcription initiation by R polymerase III on genes encoding tR, 5S rR, and other small structural Rs.
Concentration:
Storage:
Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Preservatives:
State: Purified
Specifictiy: